SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006488 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006488
Domain Number 1 Region: 377-522
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.17e-25
Family XPF/Rad1/Mus81 nuclease 0.0024
Further Details:      
 
Domain Number 2 Region: 24-93
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000131
Family DNA polymerase beta, N-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006488
Sequence length 674
Comment protein Name="PYU1_T006488" Note="Similar to MUS81: Crossover junction endonuclease MUS81 (Kluyveromyces lactis)" AED:0.160469163258511 QI:13|0.2|0|0.83|0.8|0.5|6|2|674
Sequence
MANDGGSADAAATARKRKRSAQGCVNEENDVLVEELKRVKARVRESSHLASNYSRAISSI
MHHDAVIRNASQAKQLKNIGNYIANQIHSILRKKQLLIESNPHDGDGGGGGEARDAAAAL
QRLHKQHQQAKAQKNPPAAATTANEAQLAAHAPIATRVSSENAQKEYAPAYRKQPWYVIK
VMDQENANAEAGAISVETLLLKMQQVGYDGSLPKLKACIQSLCGTHEVVRRSSAGLLFLS
EKGNRSVKLCPGSLPAPSSAPTQPPQQASLITSSSAPPQSTLSSSAIALPPVSDNPAHPS
VVCIELSDSEETVSDHEASGSEAETIRASSSPVITDSFEYEPDEEPPPYLESPPAAVEKP
PSNIYTEYEIVAASDEWELVLILDHREILSRRNRSILERKLLERNVTCEVRSLNVGDVQW
VAKRYRNGDVQEFVLNAIVERKEMRDLSGSIIDRRYTEQKARLRASGLTHIIYLAEGSFS
QQTTVRSGGLQTALCRTQVQNQFFVQFCQNADESVAFLAGVHARLLAKFPCDKCRNTEMP
SLQQRSGCQLPMQATQREFEEMFCRPAQTFSTFNALFRKKTQFTVSEIYQMMLMQVPGFS
AAKTVGVTSTHSTFRQLRDALLDHEHRSKDERVENIRCGETQRRLGVKSRECLSYLLTSA
MYNDNDAASAVPHE
Download sequence
Identical sequences K3WNE6
PYU1_T006488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]