SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006502 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006502
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000101
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006502
Sequence length 475
Comment protein Name="PYU1_T006502" Note="Similar to Rad23b: UV excision repair protein RAD23 homolog B (Mus musculus)" AED:0.126953412944125 QI:0|0.5|0|1|1|1|3|0|475
Sequence
MAREVKILVKNVYATSESQQFVVPETMLVRALKQRIHATLPGAPAVAHQKLIFGGQVCQD
TDALEHILSRNQVQSEERVDDDTAAVVFHLVLPRTPTAASAKAEAEKAARPRSASPRISV
DAANAVATQAALTGRVNVAQSADRANIDSPRPAPIATAAASAPAFDLDASLASVAAPAQS
SAFPVFGQFQGQAAATERNPQQVHQDLYTQGMLMHQQAMILAQIQYLQHVKAHYESISAQ
SGQTRAAQAQSQMPFHAPFAAPYAHFGMGMHPQMYGMHHAAGVAHPMAPAPATVAPAAPA
ATARRNPLIVQIAREILPLFDMRLAMKMAFMLFIIGQDTPNDRVLVLALLSFISYLHICG
IFAKIYEVYKRQYAVATPVDAPAGQANGADDANPHDNNGVAAPGAPGGAVTRFDFTRVLR
ISSDRGLVHDVKYFLVGLVLSLVPAWHPQPTDGGNAMPPMQDLPDAAGEIPVQGI
Download sequence
Identical sequences K3WNG0
PYU1_T006502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]