SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006560 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006560
Domain Number 1 Region: 58-296
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 7.88e-62
Family MPP-like 0.00024
Further Details:      
 
Domain Number 2 Region: 298-523
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 6.75e-41
Family MPP-like 0.001
Further Details:      
 
Domain Number 3 Region: 543-743
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 9.78e-40
Family MPP-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006560
Sequence length 815
Comment protein Name="PYU1_T006560" Note="Similar to IDE: Insulin-degrading enzyme (Homo sapiens)" AED:0.0555356288857006 QI:0|0|0|0.5|1|1|2|0|815
Sequence
MPKTQEPLRVARTPDGIHVSPLDERQYRHLTLRNGLQALVELFSDIRNTGRAKPSFAGEL
PFNKEHLARRLDVVPVKDLKIVGVTWQLPPVRGVRYTQQHTSVLAHLIGHEGQGSLLSYL
KKNKWVNSLSAGIDEEHDEFSLFLINLDVTEDGIAHLEDVLLALFQYLQLLTESQFEKWM
FEELENLAIMHFLFQSKHHPINYTSSIAGIMQSHPKQDILTQGTLHYPYECEQIQELLQL
MTPANMKLLVVCKSMEPVATSEEKWYGTKYRDTPLSAEFLQKMSAPEKNPALFLPGRNEF
ISSDFALIDKSQVNEQQKYPALVRDDDMCRLWMKSDVHFKKPKIHAALTFHSPLVNNSPL
AYALSDLFVMCIQDELTEYAYDASLAGMHYDLAVRGSTIHLGAIGYSAKLPVLVRRIVEV
MTSFADHIKEETFDRVKQAACRAYENVKLEEAFRHAMHETTFFLQEVAWTHDELITAVGQ
CTFAMLVNHSHRTFQQVFLEAFLYGNVTQEGALEIASMVVEQIHRPFSLPVAESQRYWMA
RQINLPQGVECIYRKLDPNPDNTNCALDSVYHIGEENLLDRVKLALFSQIAQEPLFNQLR
TKEQLGYTVFSTPARSNGIQFFRIILQSNVAAPEYLEQRIDAFWSDFRASLVSMDTAQFQ
KYIQTIVKEYSEKPKSQEEEVQFLLTEITNHEYVFDRKEVLAQLVTTLQPSDVLQFYDEH
ISPSATKRKKLSVEIFGNTTPLVRLQGNEAETTGLSPWKCSTQAGLLAAMTLGASADGQA
SDGTTKLFIDDPREFKRRATFYGLPTPRVVDKKSC
Download sequence
Identical sequences K3WNL8
PYU1_T006560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]