SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006583 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006583
Domain Number 1 Region: 63-114
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000619
Family Leucine zipper domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006583
Sequence length 282
Comment protein Name="PYU1_T006583" Note="Similar to TGA1B: TGACG-sequence-specific DNA-binding protein TGA-1B (Fragment) (Nicotiana tabacum)" AED:0.074468085106383 QI:0|0|0|0.5|0|0|2|0|282
Sequence
MAPRDGRMAITAICDPMDVSEAAAYASMPPVHPHKPSRHPSPFALLPFAAASSSSLLKSE
ATKKRSRRMSNSERGKLYRSRRKNYVESLEGEVQDLKQEVQSLQVYGSILQDLVLHAPHT
NGGSFSRVVAEYFTLFETGIPLPSQYQQHHRHHSSVLSKSSMHQSGEVALRPSARQAVFV
NTLMETNMAFCGNGGTKRLLQNWEFFSVNHASLHYRLTELQMVLSDEPTTAVVSANAVLH
KLVGLEIEYTVGNRFYFSRDSGKIYKYESEVDFLSAFMAVLG
Download sequence
Identical sequences K3WNP1
PYU1_T006583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]