SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006586 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006586
Domain Number - Region: 78-125
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0608
Family Leucine zipper domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006586
Sequence length 414
Comment protein Name="PYU1_T006586" Note="Protein of unknown function" AED:0.225204819277108 QI:0|-1|0|1|-1|1|1|0|414
Sequence
MSDATTSSPMDRASTYASPPRPLPSALASLSRPKRSPRNVNKLLFGMLQSMADLHALSAS
SSDDGFQSEQVRKVTIKPNVKLMSNSERGKYYRRKRKLYATELQDHVQKLRRQVDTLLAK
QQLRNELSIGINQTPVGSFARVVQAYLMQFEYGTPVVLKQVQGNNNALTTKRVAMATHQQ
ADFLRSAMEENVGFGDFRGIDLLLDQWERYSLYHASLRYEFKSLDVIAGSSNDNDNDNGN
GDEQVPPVIIIRADLHVKFSRETIENVFPHLLDDEELLEKFIGLNVTYPCVNHFYFGTNG
KIMRYNPEVDFMGAFLRTVRSIEGASHVLSHALIAKDHMIGMQEEDHNKFEYHDGTQDNN
EISYADVACRPEMASMHTELGQREEEKDICGPDGTSSLPAVSVKSRLDLKFILS
Download sequence
Identical sequences K3WNP4
PYU1_T006586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]