SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006587 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006587
Domain Number - Region: 53-172
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0942
Family 3-Methyladenine DNA glycosylase III (MagIII) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006587
Sequence length 176
Comment protein Name="PYU1_T006587" Note="Protein of unknown function" AED:0.282714680465354 QI:0|0|0|0.33|1|1|3|0|176
Sequence
MDILEAREAQLHEQLFGARAVATTITAGSVSITNRIQALNAHVDHLYGAVTGFSKLSEMH
NNAQPELEMQPSSTLGSNASKSGEEMKRAVILSSDDRINAVVKEFHKLKEMQGVLAQLEQ
LHNRHPVDQQQLEALENKTDLHTQRALALHARVERILSEKCVEYSALLDHLASAAP
Download sequence
Identical sequences K3WNP5
PYU1_T006587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]