SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006616 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006616
Domain Number - Region: 67-109
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0101
Family Leucine zipper domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006616
Sequence length 463
Comment protein Name="PYU1_T006616" Note="Protein of unknown function" AED:0.379476476483746 QI:0|0|0|0.66|1|1|3|0|463
Sequence
MPPMRVLRSEPSVQSGDRGDGDKAVAGSLKRQKRKAATSSTSLAPFALAEATAETKDDDT
LALASDEEKKEKNRNSVRRSYYRKIETLGELRAHADDLRRQYNDMLQQWEGRFLPGSDDA
DNAKKSALLLRYMELSRLRDELWTENQQLQDSFEDREKSAFRLQRLFDVNYQLMDHSAHG
GANNGERVSFPSPVLIMEEMSFEAFTRFAQDALSQVESFLANKQQMTATNQVLGWKSSHV
VDDNALRFYFEKQFTSPMAVHDVAQKAWETLTSPEKHSELYARTLHVRFHVMQIFDSNSC
VLYRTMEKEGEDSITTALIVMTRIERSNNGGCLIICKGLKKAEHKLHMESMSEYTLHKKK
IWRESMYWLSVEKSSDGADEPNAVVHDGSALASSSFETCRLKVAHGGIMNNMGDRSPSFW
LFENLLIALRWESKLGLETKPSGASPSEPLLSGEDHGQVVHSE
Download sequence
Identical sequences K3WNS4
PYU1_T006616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]