SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006630 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006630
Domain Number - Region: 57-103
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00144
Family Leucine zipper domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006630
Sequence length 336
Comment protein Name="PYU1_T006630" Note="Protein of unknown function" AED:0.472420200227405 QI:0|-1|0|1|-1|1|1|0|336
Sequence
MVPLMRALPPRAAISVMAPNDAPSPHDPDDALSPDEAVRRVVLAAHSKQASRLSATRKNN
SERARRYRKRKKERIGHTVGEVETLRKRVEELCARRQLYEERLWNAPFAASNIALKLVQE
YFSVFRYGMPLSPSSSSALTPSRRALDVPANKQELFLERIAHPDVMFNEFIGVHPLIDQW
RKYSHFHTSVRLEFVSFRMRTIDNCPIVSTCGVLHVGYSRKTLENLFPHVLAREDMVQKL
VGKELHLRYHDDFYFNERGQMIKYDLTPDLVGALQEVVGNLHDVALLLGDAMIEQGAVIR
QELRREDEDDERGYALLRNGGANSPSCVMDIDFILS
Download sequence
Identical sequences K3WNT8
PYU1_T006630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]