SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006638 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006638
Domain Number 1 Region: 127-249,298-424
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.2e-44
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.013
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily F-box domain 0.0000157
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006638
Sequence length 461
Comment protein Name="PYU1_T006638" Note="Similar to At1g78280: F-box protein At1g78280 (Arabidopsis thaliana)" AED:0.251082251082251 QI:0|0|0|0.2|0.75|0.6|5|0|461
Sequence
MNWQPALATSAFRGLHDELVAYFTLFCDVDDLLALSETNSVFYVFSREEPLWMAHCLRRH
GGEFTYKDNWRLTTFFPRNRPVDMPLFPTLSIRGFASDFLYRRWYRAHMSLKVFDLPDEQ
QDPFAKRIKKFETKDITYQEYFEQYSRIPFILKNAIGNWKATTEWTMEKLTERFPSDIKH
RITHNLDFFGSGKSLKMSFADYFQYIRHQNDETPLYIFDPNFGEKAPALLEDYNVEDLKF
FKEDMLKVVAQEKQAKQKSTDCAFKSEASKQLEQKTEGKSTVSQSSEKVQDVKPAVAESL
RPDFRWTVIGPERTGAPWHTDPARTSAWNALVKGRKRWAIYPPDSPPPGVSTGKNGQGRE
HALNMTSLSWYLHVYPTLLPHQKPIEIIQEEGEVIYVPSGWWHLILNLDMTIAVTQNFVD
SHNLMAFVKDLLSDQEHEALGQFQHKIKTDRPETFLVVTGI
Download sequence
Identical sequences K3WNU6
PYU1_T006638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]