SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006641 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006641
Domain Number 1 Region: 46-264
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000000044
Family STAR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006641
Sequence length 352
Comment protein Name="PYU1_T006641" Note="Protein of unknown function" AED:0.118934723000712 QI:0|0|0|0.66|1|1|3|0|352
Sequence
MKLPLPPDFFAPVRLSHEETAQLQMVEAQLLDAYLDRYEECALGNNGAVEGKHWKFVRQR
DGVRVYKRRTRRRMWPHHDQENDRRGRQIEHSHLPGILIVGSVEGTVEDILYGTMWDSRE
DRMARAYFTGDGIADAAVLHTLEGATTLDPFRSLAVKWTLKKAPTASVLVKDRDFCFLGS
TGVIRTQNGDKVGYELRHSIKFPSCPRFENSSVVRAQMYFCSFFRQLKNGRVEVFHQGSY
DASGDLLSMLATKSAVASFANFTKILDCSFAKKLMRAIRRSEEREEAMSISSAQESVDDE
RRCGMCLSRLGSALKRKCAVCRHYAERSPGNIAHQSARALLLQVVCGEGAAR
Download sequence
Identical sequences K3WNU9
PYU1_T006641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]