SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006644 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006644
Domain Number - Region: 76-115
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00707
Family Leucine zipper domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006644
Sequence length 338
Comment protein Name="PYU1_T006644" Note="Protein of unknown function" AED:0.163033165909272 QI:0|0|0|1|1|1|2|0|338
Sequence
MFQVARITSDFRKPQTSFELVKPHAPPRGRSALAPIKATSGDSDIELELTTVKKKAKHQQ
IRQASKTKKLSTERSRLCRQRQKMYAENLETTVRALQFELQDLQMLRDLRREQIFATRSS
PAGSLTKIINEYCTVFRYGMASETAPNASGSMLKKRALTLTNELTPAAQREFMNSVMDPQ
VEVFDWCAAAERMEAFALWHSSLVFEVDFIEAVNAEEALAVRTQGRLRVRVSEQTIQYLF
PHIANSEQLRNRLIGQEVVYSLRDTFYFSEECRVVKYNVDIDFIGGLHAVIGNYSDVLQL
VKPADQPPLDDLAIRPPHSDPVSSDSPRSRLDVQYLLS
Download sequence
Identical sequences K3WNV2
PYU1_T006644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]