SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006645 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006645
Domain Number - Region: 76-115
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00796
Family Leucine zipper domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006645
Sequence length 346
Comment protein Name="PYU1_T006645" Note="Protein of unknown function" AED:0.144092219020173 QI:0|-1|0|1|-1|1|1|0|346
Sequence
MFQVARITSDFRKPQTSFELVKPHAPPRGRSALAPIKATSGDSDIELELTTVKKKAKHQQ
IRQASKTKKLSTERSRLCRQRQKMYAENLETTVRALQFELQDLQMLRDLRREQIFATRSS
PAGSLTKIINEYCTVFRYGMASETAPNASGSMLKKRALTLTNELTPAAQREFMNSVMDPQ
VEVFDWCGRSAFGPQPLLNGWEAFALWHSSLVFEVDFIEAVNAEEALAVRTQGRLRVRVS
EQTIQYLFPHIANSEQLRNRLIGQEVVYSLRDTFYFSEECRVVKYNVDIDFIGGLHAVIG
NYSDVLQLVKPADQPPLDDLAIRPPHSDPVSSDSPRSRLDVQYLLS
Download sequence
Identical sequences K3WNV3
PYU1_T006645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]