SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006706 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006706
Domain Number 1 Region: 85-417
Classification Level Classification E-value
Superfamily Acid proteases 1.21e-74
Family Pepsin-like 0.00000646
Further Details:      
 
Domain Number 2 Region: 463-717
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000659
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006706
Sequence length 740
Comment protein Name="PYU1_T006706" Note="Similar to PGC: Gastricsin (Monodelphis domestica)" AED:0.0363447413795627 QI:0|-1|0|1|-1|1|1|0|740
Sequence
MRSASELLHVHHRSPASGDESKLMKAQEAEATTALDSQKTQTVIRADDVVSAAAVTKTPK
SMGTMQSAADTSTWLHDAQDLAAAGHIPLVNFMEFQFFGPVTIGTPPQEILVCFDTGSSD
LWVPGAKCKECAGTDRFQSSKSSTFTQARDGRFAVQYGSGKVSGRFGHDTVRVAQYEIKN
GIVGVVTDEEESMAKMKADGLLGLAFDGLATFSDPPLFFTLLEQYPDLDPVFAFYLSPEP
NSNGSQLHIGGYDESYMTSIDAEWQLTEVLPQFGLWTFWRVSLHNVRMGDKGSNLCTDEC
VAFVDSGTSLIGIPSNLYLDFLYDVANYAQDQGCYCGFVEYGFQCFLCSPQDFPPMRIGV
AGKHFYVLEGEDYTLCVGLTCIVLVQPSGQDMWVLGDVFMKKFYSLYDVRKKQIGFACIK
GSPLCGLDDGREIGANNNGAIPSSGALSPFFENSFDLYDMDSHSVLVLFVSGLSLVGSAF
IIGSFWHYPQLRQKRALSLLFWLSACNFVYCLSVWVAGIAHVPQSTAFCGILMGVQQFNG
TAILMFSGCIALELVRVIRGYRASTVDYTRVYYVLTWTSAMFCGLFAMLTGVIGFLPDLF
GPCRFCFVGHSPEWARMFLFYFPACLTIFLSFVAVHLVTQTRQERAMGSQSEADRRSTKH
LLACTVVTLVTFVLPTFVGFLMAFNVFASSSIWLYVNEVCFYAQGLLNCLVWAFSPSFRG
AYHNRNNASHGEATRLMGGL
Download sequence
Identical sequences K3WP14
PYU1_T006706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]