SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006741 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006741
Domain Number 1 Region: 83-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000906
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006741
Sequence length 190
Comment protein Name="PYU1_T006741" Note="Protein of unknown function" AED:1 QI:0|0|0|0|1|1|4|0|190
Sequence
MTDLVFDAATSATSAAADNQEEEKPSHVFGSIPYERVLSIAECKRLETSEQRLHDRLDQI
VHVWVRDARSFRYGRPSDIPPFSLRLHLSLPIAELRDMIQEQFAHLSTYNEATDDALHLM
YNGRVLENGNQLAEYVVTSESSRSSPLEKRAAGHAQWPRPFVGIIWVTPFRPLRSTPIEW
GDGAFVSPSS
Download sequence
Identical sequences K3WP49
PYU1_T006741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]