SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006745 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006745
Domain Number 1 Region: 629-939
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.31e-75
Family Oxysterol-binding protein 0.0015
Further Details:      
 
Domain Number 2 Region: 18-117
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-22
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 290-341,403-510
Classification Level Classification E-value
Superfamily Bet v1-like 1.4e-16
Family STAR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006745
Sequence length 954
Comment protein Name="PYU1_T006745" Note="Similar to osbI: Oxysterol-binding protein 9 (Dictyostelium discoideum)" AED:0.00418848167539265 QI:0|0|0|0.5|1|1|2|0|954
Sequence
MLPERKPIETLAEFDATCMKEGYLQKKGQRLKGWKRRWFVCDARTLSYYISRKDRKPNAV
IPLEGCSVQDGGLSETWNSPRIYLTDGTNGVMYCLSSEDGEAVTQWLAVLRNAVAKVNGT
SDSASEDAAPQQSKNRNGNATRAATAAKGASDEENAKHAAARTTQLKSSSSTTSETTTGE
PKKRMVRLTSGTGQSLLSTAAAQGGGAAPASRGATQTHNQQQYHQGHHGRSKVQHLPTNI
ALENDLSNGLDVLESLLCSSNKSSSGRRNAVVFRPLGATNGVLRSIGKDAVSGKEYARAS
VVLPVSSEVAAYLLADHAKRAEWDLHFPHSSHVASFDDTTDLVHLSSGTSSTSGKFSQLQ
MTKPFLPPQVAAAACSAGALLLSGASWDAMLTNIVYAGAVGGVVNSMDYSALCAPRDLLL
LRHVRETSVLDSQSNNASCSDLLNAEGEECGQSMVLILEKSVTNELKLPTSGVVRAHVGL
SGWLLEPVDVSRTLATYVTDVDMKGWVSPATKRQFLLDRLDCVAVLLEYVTQTQLCGAAR
GLGFDGDESDDDDDHHRGISSGKDLSRNDSEFDDHDGSSSAASGVFNSAGGSAEFHPRAY
MRSMVRTPTGGLKLIDKEVAKKQGGVLKDVIKSAGAKILEGKSAVSLSLPVRIFEPRTNL
ERITDMFLYAPTFLNMAAEQTDPAERLKYVVAFVIAGLHHAVGQLKPFNPILGETYQATM
NDGTDVCCEHTSHHPPISNFQLVSKKFSLAGHVLWHGAISMKSNALIQINKGPIRVSFDD
GTVISYTLPHVQLGGFMWGDRTFDITSTIVFEDPKHHLACEVKFNPDEKKGMGGMFSSSK
TPSDCFRGALTSNGAELCEVSGSWLDELKFGDVNYWTMNKEPSGYLVAFQETKLLPSDSR
RREDLRALAANDLDDAQDWKVKLEVLQRADRKVRNDGRRPNHWTLKDGHDKASH
Download sequence
Identical sequences K3WP53
PYU1_T006745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]