SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006752 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006752
Domain Number - Region: 85-157
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0129
Family Mitotic arrest deficient-like 1, Mad1 0.0038
Further Details:      
 
Domain Number - Region: 63-101
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0889
Family Leucine zipper domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006752
Sequence length 488
Comment protein Name="PYU1_T006752" Note="Similar to NST1: Stress response protein NST1 (Pichia stipitis)" AED:0.0486286539155539 QI:0|0.5|0|1|1|1|3|0|488
Sequence
MNADMVTPLLQDWDDEDREMMQFLLLGGSPSGVDYAGDVVPSLPEQQPPQNPKHSKAKLS
AMERREKHREVVRRSYHRNKAVLMDLRDTVKKLEEQMKALAVEKRMKGDADGAQQEMPRG
DRSITTVATGKEGNQQLEELQRECDALKAQSQALESESTQLRETLKTHQQFIDAVYMASD
DTSEEDESGDSDDCFSVDRTKLSSPWSEPTFPETSDEDFSPDKRKKTKFYSSPRPAHAVD
VLPRARLSTELWRDIGFKHLSLSTARMLVNEAYQGILNFSLSGQAMSTGARVMGWEDKRL
MDGSTIKFSLRKKFMGQKANELMTKTWMCLSDPDCADEKFRGLLTLRILQHVNDDTIIAL
RDTVSPDNSTVFRCVYLLFRVRTRAGFIICSRSINHACVGAGDQVTHTKDGKVIHWVNLF
GWFVFDQLGYADHSSSVFHETGAQLEYGGSMNYGDASHLPALAMDTLSIVSRWESFMIPP
VFVLPPSF
Download sequence
Identical sequences K3WP60
PYU1_T006752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]