SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006875 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T006875
Domain Number - Region: 61-119
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0753
Family Centromere-binding 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006875
Sequence length 328
Comment protein Name="PYU1_T006875" Note="Similar to Pogk: Pogo transposable element with KRAB domain (Mus musculus)" AED:0.0494505494505495 QI:0|-1|0|1|-1|1|1|0|328
Sequence
MQRGVSFREFCRSKVLKHSTLQRWARIYPKLKVALCPDDEWRRKGSRARRLTVGGSGRVS
KSRPVEDELLRHIKDLRRSEIVVTRQHIIDYARSLMPDLFTDAMDEACKAWSSRFMCRTG
LTMRRITHSGRTTRADLEKLRVDFVQAVVDTMFQHVFNPFSCICPRHTVFNMDQIVIFAT
AGARSTVEEEGAKIVPARAGGSETFRCIATITASADSRIFPLHFVYKGVEGGTVEDEVSR
FALDTVASFSVQEKAWFDERVTLKWIDRSWKFVVAEPCILLLDSLHVHMSETVLSALVDL
GTLVQHVPPGATGIAQPLDVGVISPFKH
Download sequence
Identical sequences K3WPI3
PYU1_T006875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]