SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006910 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006910
Domain Number 1 Region: 217-329
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-24
Family Ankyrin repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 550-688
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000203
Family Synaptotagmin-like (S variant) 0.045
Further Details:      
 
Domain Number 3 Region: 49-78
Classification Level Classification E-value
Superfamily WW domain 0.0000907
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006910
Sequence length 712
Comment protein Name="PYU1_T006910" Note="Similar to CTTNBP2: Cortactin-binding protein 2 (Callicebus moloch)" AED:0.0281558351424316 QI:0|1|0.66|1|1|1|6|0|712
Sequence
MGDDDEERDDGRSLPLPALSELDQARVIRIQKLIRGRLARKRGEAVAGEFYRKCWDAFSG
FAYYYNVRTGASMWRKPLLLGSTDTEWVESSFAGGAADCTADLAVAATDDAPRRENGSNQ
PFAVLTFAPTPPSAASMAQWKKHFEDGVMFQQQCAKDKQELMKRHRKKIARAMQHWDHKL
LKEKERRRAMRADQLKADNQQMLNDLYNGKLKQNVETIREAAMRGHVDRVRELLEIGFSA
NAESAMGLTPLCAACQNGQYEAVKLLLANGADVNHAHVKTGRTALMEAGARANASIVKEL
LRYGAQLYVRDTHGETVFDEMKDSGIQKIVIMACESWTAANASLFPTEFRMATLAFAYIA
KRQYESFLRKKDSTRREVLSMKQSLQRLLAEAKMRHDEDKRVCHAQITILRKLESLEAAD
ARYDGERSRILKSIEDTLDMLCSSRQPRYLTESVVLKILGYCGRHWFEMDPQSKKRNKSK
RKKIHKKGRQLPIEPTKLRDPPDKFPGDLVVEWDTFHAKLKTHCTLLRSTETQERADVES
GVSRDSNGVSQATLDICIVKAENLPLRDMRTGEPMDPFVRVSLRSASSKDLGGTLVCETS
MRLADRHPEWDFSHQMAGVPSIHEAILIQVIDNKRQEVAGEASIPLRSLLDQKEHDEWHV
LPPTLRQQLVEKQPRQRPARIHLKVKFIHTKVRETLGSTVPEHVVRKLTTDP
Download sequence
Identical sequences K3WPL8
PYU1_T006910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]