SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006984 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006984
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000765
Family FHA domain 0.0035
Further Details:      
 
Domain Number 2 Region: 117-188
Classification Level Classification E-value
Superfamily BRCT domain 0.000000425
Family BRCT domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006984
Sequence length 637
Comment protein Name="PYU1_T006984" Note="Similar to NBN: Nibrin (Gallus gallus)" AED:0.170846394984326 QI:0|0|0|1|1|1|2|0|637
Sequence
MWVLDVMNTASSAVENTFYLVAGEWSIGRKKCHFNFQADSSISRSHALLCVGTLPLEQLK
DTATRPSLVLVDQNSRFGSFVNQEQCFTERELKNGDQITFGAKKTILRVRYQVFILVASR
IQRTSRARVNETCQRIGMHLIASESKDATHCIMDPGKIVATVKVLWALVYNQPVVCTPWI
YAILKRKSLSEPLPRCEDYLPIDELMPSITNKYLPNPMRKTLFSRHVVVFLIPQSMEEII
AEMAGVVISAYKDTSDHDDLLLRGIEQHASSRHVLIVEPTQASGFSSAAASSDGRDHLQS
GAAVCSHAIVERRVSLFRSIGAAFVTIQELAASVLFVKTPSTSNELSFSNSLAGHNSSSV
QIMSFPEHLSLYPPSAEPESDEAAEETSTLVKEENTRTPTPNVLVARITTTAAAPRPHDK
IVNLRAARREPESIPSDHIQQVKEENVESDVSVVKEELPVMASSQDHERVYLNASQRAGE
GHSHPFSATNVLSLEPFAKRESECGSGSALARGWVSTLSSTPHQSQNHYKAEEEDEEPEH
KPVVVSCNLIVKRPVPAIRFHGNGAGGVNFKRFKKGNGYGARSNTASLFPQQMVVSVTVD
NADRVALEENLEVLEEQERIADELFAMAENRNSRRRF
Download sequence
Identical sequences K3WPU2
PYU1_T006984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]