SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006990 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006990
Domain Number 1 Region: 336-621
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-51
Family Protein kinases, catalytic subunit 0.00066
Further Details:      
 
Weak hits

Sequence:  PYU1_T006990
Domain Number - Region: 83-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000351
Family DIX domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006990
Sequence length 631
Comment protein Name="PYU1_T006990" Note="Similar to Stk16: Serine/threonine-protein kinase 16 (Rattus norvegicus)" AED:0.246186762618805 QI:0|0.66|0.42|1|1|1|7|0|631
Sequence
MSASEVHPLASPSMSLDPQKARVHRTRTWDAPLQPHQQRASVPRFVLYTLVGEELEPVEE
TKSHAPDTNWNAFVLEKSGNDHGGAICLRDVQRAFPLGGAFHFAFRNGQGVFLDLTNPSA
VVPFWDHKIVARVTPLIAEPEIAYVAYGGEPVAHDEAQEEYEHDRVPYVEHRMHDADEYL
EFQSTTYESQDEDVPMPASRDERRRGDSDWTSSNASSSSGDSPYQSHRGRHSHSHADDHY
DGNSMSSSGGGGERSSSASAAAKDAQAFLRKQTEQAYDFAKKISMEDAKKGATETAKKAK
KWGGSLLSSISASISNATGAVKNETIQVGGITVNVVRSVAEGAYAQVLLVRSVATNETFA
LKRVICQSEEVEKDVHMELQVFRSVKHLNIMPLVEFAEARQQNLEFYFLFPYFERGSLWD
GIDAARNSSSPLWPFTQRVALHLFHGICSGVLALHRAGFCHRDLKPHNILLSSSSSGEDF
LSYIPLVTDFGSCSPIRVEVRSRRNSLDIQDEANRKSSAPYRAPELFEPTVESVVDGQSD
VWSLGCILYAMAFGGNPFEHPREGFMKLAAMNGRVSFPPEQAGAIRHRSAVFSHEFCDFI
RDMLHVNPEERPSVLDALEFTEELLHDEMNR
Download sequence
Identical sequences K3WPU8
PYU1_T006990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]