SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007000 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007000
Domain Number 1 Region: 354-518
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-36
Family Ypt/Rab-GAP domain of gyp1p 0.0028
Further Details:      
 
Domain Number 2 Region: 499-612
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 
Weak hits

Sequence:  PYU1_T007000
Domain Number - Region: 9-115
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00348
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007000
Sequence length 706
Comment protein Name="PYU1_T007000" Note="Similar to sgsm3: Small G protein signaling modulator 3 (Danio rerio)" AED:0.0647319756829801 QI:0|1|0.5|1|1|1|4|0|706
Sequence
MTPTCRRNKLWLEVVGARNLESRQAVDAYCVVQQLVVPAPVTVKLHAQEKGQDAAALPSR
SPTIQSSGNPAWSHAIELDIVEDGGDAADPVSSTLASDPRVMIQVFNEKNFFFDMFPASS
GSSSSSSPKSAVDASAADEDSRQEMMDREEEGEEEGSNRGKLDSLCLSHETDSDDDEDRE
LGLIDYAFVDTTPKAKIKRLNSSITPVERISDKKTTRNSTPAAPAPIATQSEGLDPSDEA
LGFLELSVALLRKSSRIATDKWYVLRGTRSGEIRIRTLWLDDATLATDEQARERIFAEQV
YEVPMYDHYGFRISDRLQKDWAHLRSYEDCREERRVSDWERAFGTQFFSLQHHRDFLASE
NTVLRQLARGGIPRHWRERVYMNLSGAREKQQNAGSQDYKSLVEQSEGVDSAPFRQIELD
IDRTFGHSGTKICTEEGRAVLRRILRAYSIRNPSIGYCQGLNFIVGFLTLAVEEEAAFWL
LAVICEDLYPGYYTPTMAETQTDMLVLKELIADELPALDAFTADVGLPLELLGSQWLLCL
FTTTFPSETVFRIFDCIFAEGSRFVFAVIIAHLRRLESTLIRLEDFQAVLSAMKDAENAL
LDADRFMVDAVQEADRIEESRITALREKHRESVRDEMNRAARARALNKQLAVVYQIPAFS
NYAASLLRFFHEEAEVSSRSDVAFILTLLCHGLVWLAEHSQRWQRQ
Download sequence
Identical sequences K3WPV8
PYU1_T007000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]