SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007018 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T007018
Domain Number - Region: 47-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000131
Family Single strand DNA-binding domain, SSB 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007018
Sequence length 564
Comment protein Name="PYU1_T007018" Note="Protein of unknown function" AED:0.190619515154031 QI:0|0|0|0.6|1|1|5|0|564
Sequence
MMQQQKQQKQQKQQRGTNFTVVIQQISAGKRAVVGLQKQRVSTHHVLHLADVSRSFFKMT
CWGEAVPILPLDDHAPEDIALRVGDIVLFTNCQVKSFRGNIEVQFLRASSNVQLLYWKDR
YFNTRDVRLKDLYSMIEWYKQHRREFLFMTSDSGDGSSTSYSSEGFAADLAHSSSMHTKI
RDLRKNMVANVVYRLRDLKPSESAAMGANLVLLHGHIHTSRAIESTDFDGHAETKFVAQL
LAHPGVIEIKGIVISLDGLSNRLLANTTPQTQFEFIDAPSKDKDAREICKRLGAKKLIAP
VLSTSPAVFGSLEELENSSSFDDLIVLDNLRIEQICVGQRVGSATRVLSQFAQLLVESYC
SVCDGILPELQLNAIPPLYGPCTRRCRVRNGKKERLWRYRRFQMVVRDAHHQRLQLEVEP
CAMFEFMGNIEAKMLIHPHIDGQQPPFNVKCAVSSLLNALVDDASQMFRAEIRRDHIGAW
QPGETIRDNSVNISQNASQQQNAKIQVKDWEKKTIGSGKSGFALERPVSGDRQTGNEKQV
HDQVNAPSTKQNNLARDNGITKIY
Download sequence
Identical sequences K3WPX6
PYU1_T007018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]