SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007089 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007089
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily PTPA-like 4.71e-114
Family PTPA-like 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007089
Sequence length 368
Comment protein Name="PYU1_T007089" Note="Similar to ppp2r4A: Probable serine/threonine-protein phosphatase 2A activator 1 (Dictyostelium discoideum)" AED:0.0951622754739583 QI:0|0.5|0.4|0.6|1|1|5|0|368
Sequence
MSESDYREPTRAIFVESDLRKFVGSTAHQMILVFVKHLNESVKGKSVDSEYDVSPNVQKA
VDMIIEIDSWVDEIPPIQQPMRFGNRAFRDFYDRVVTRSNELQQQLLPENLHGAIIELST
YLNECFGNRVRIDYGTGHETSFVVWMCCLHKIGFFTQHDFPAMVLRLFHAYLALMRRLQK
LYMLEPAGSHGVWGLDDYHCLPFYFGAAQLIGQTQILPASIHDDAVLEAHCENYLYLDAI
KFIKEVKSGSPFAETSPMLNDISALPSWEKINGGMLKLYEGEVLKKLPVIQHLCFGTLFP
CTWTPSHSAADGSVYTPVSMHPGTAVHAPNFDLAGATAKAPWVAVEDLAAVRDTQMSPIP
KGTKHPAT
Download sequence
Identical sequences K3WQ47
PYU1_T007089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]