SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007098 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007098
Domain Number 1 Region: 316-403,567-685,1249-1493
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-36
Family Calcium ATPase, transmembrane domain M 0.04
Further Details:      
 
Domain Number 2 Region: 679-703,894-1004,1169-1245
Classification Level Classification E-value
Superfamily HAD-like 2.64e-32
Family Meta-cation ATPase, catalytic domain P 0.046
Further Details:      
 
Domain Number 3 Region: 698-906
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.79e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 
Domain Number 4 Region: 417-475,525-564
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000017
Family Calcium ATPase, transduction domain A 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007098
Sequence length 1585
Comment protein Name="PYU1_T007098" Note="Similar to Atp8a1: Probable phospholipid-transporting ATPase IA (Mus musculus)" AED:0.163080104063711 QI:0|0.5|0|0.66|1|1|3|0|1585
Sequence
MKVVEFAVPSPSQEDVANGNYHLGIEIDADKPAPVSSGSHHQPPNSQTKSMRRMNTFTGG
LPEEEQRNIISLRYRADSMADSIASEEEESAEAKVWNVFERVFCFLKGMTIYQVRRRLKF
TIITQSVINTSRIFPIILGLSYQATLPVLILYITLILGWHGTKFLVPKFLLLYKIGMQLS
LLVDVIWYWKGYNGKLNRGVSLGTATLMQGFFSILLSILNVAGLLYGWKLRRIVKAVQNQ
RECDRAALATMMPPSPTRANSMQGLRQTLSVNPIADVPEEERAATRRTIMVGPGSQGGRR
RSSVGSSGKPGENAPAFCSNSIRTSKYTYYNFPFVFLKMQFSRLANFYTTIVVALCFFSF
SPVSPVASLTPLLIVFATSALKDVSEDLRRQKADTQVNTKPCHIVRRDSSGVIKHVDAMW
QDIEIGDLLILKDGDDVPADCVLLATNRPDGRCYIETANLDGETNLKIRTVAKPTKHFLT
PDAILERYQLHIECDAPNKDLFYFDGVLKLTSIQSEEGDANASNAVEDTSLTMENLILRG
SESRNAEWTIALVIYTGKETKISMNSSDVPLKRSFVEKTLDTMFVLVLVLLFGISVACTL
GNNNWNWDLDDDKSPWYIGKNVENGYIFLSYVILFNNLIPLSMYVTMEGVRFVHARYIEN
DLEMYDPHTDTPAQVRNSNINEDLGQIQYIFSDKTGTLTRNEMIFAKCTIAGLRYNDIDM
DSVKPPRPGTRFNDSRLIGRLNANHSTKKEIHDFMLLLTICNTVIPEYDTPAAEASGLSS
VTGKVKYNASSPDEQALVLAANDLGYVLTGRDGPICHTLIQGVPMSFEILNVLEFNSDRK
RMSIIFRHPDGSIILYCKGADDIIFDLLSKSQPQGVAHVTRGHLQEYASEGLRTLTTAMR
RLTNEQYEEWHQLYRQAELSLDNRAAKIAKVSAVIEVELTLLGATAIEDRLQDGVEECIT
SLRKAGINFWVLTGDKKETALSIGMSSHVIDDNMDVIVLGQRDKASLRAKLEELYVDLVD
DKWGSDEHSSAVSVLFEAFKRVFLMGWDLAKTAILGRDVQAEARKKRRRAPRRDEHAGGN
DVTPTDSQTQFDEVYPALNIDESGVSQEHGHCDRQFEPKSDLQNVSEEFVDEELEFAMVI
DGKTLALLLEDDIKYLFLSVATQCKSVICCRCSPAQKASVVKLVTEPTLMFSPGNITLAI
GDGANDVPMIQAANVGIGISGKEGRQAVLSSDYSFAEFRFLKRLLLVHGNYSYKRISKLI
LFSFMKNVALSLSNFFLAMQTMYSGVLMYFGIFFTLYNALFTTIPIVFIAMYNQDVSSAV
LMQYPTLYINGLKNRSFNWITFFGWCGLGMWHAYVIYAVPFFSNGFIVWYFARDAGNEYL
FGSRDLGFWADGVAAYTYLITASTVQVALMTSNWTRANILSTIGTLVFYYLFMAFFCNVY
GWTEKEFYETENGYGVLGQLFSVAWFWFGLLLAVVGAVLPNFIAKAGRVLFYPEPSHLMR
EWNRLAKGEDAAVMLNSPRLVRRNTGFAFSHYPGESEMAMSSYRNNVIQQQQSSSSPFYQ
PSPSTSSTAEESTPSKRSTTTLDSK
Download sequence
Identical sequences K3WQ56
PYU1_T007098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]