SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007105 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007105
Domain Number 1 Region: 45-235
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000915
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007105
Sequence length 239
Comment protein Name="PYU1_T007105" Note="Similar to carD: Cyclic AMP receptor 4 (Dictyostelium discoideum)" AED:0.0803571428571429 QI:0|0|0|0.5|1|1|2|0|239
Sequence
MMLEASLTQGAATAAAGDGGDDGVSSFVKALQQHVANEASRARAIIAVCSSVSLIAALAL
ILCFLVFQESRRCGRRLLLCLHLADAGAACAWLLVLWLPEANPDAGAASYTTPGVCYAQG
YLLLFFLLASYLWTACFAFHLFQLLGRRIKAPEAYEGRYHIVSWGVPLLTVLHVYLQQAL
GYHLVGESGLPWCWLRSWSDFEWVAGAVYVQLGVFYGPVLLIWLHNATTYLSLLYKMQS
Download sequence
Identical sequences K3WQ63
PYU1_T007105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]