SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007126 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007126
Domain Number 1 Region: 4-45
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000896
Family Psq domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007126
Sequence length 176
Comment protein Name="PYU1_T007126" Note="Similar to TPRXL: Putative protein TPRXL (Homo sapiens)" AED:1 QI:0|-1|0|0|-1|1|1|0|176
Sequence
MTNTDAKMQLAIAAVATGGMSVREAARRHGVPRTTLQRKLSKDPQHANSARSNSVTSPEA
GGGTGSDTNSMSPSSSSYAAATKGAARVSALNVTPVSTMNAAAMNPAASFGSILDGTQNT
IGSFLSLNSVNGTTTTSSRKRSADAMNSPEKQLPPQPLGKGESELFLVVRSMDVSV
Download sequence
Identical sequences K3WQ84
PYU1_T007126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]