SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007141 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007141
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-18
Family Canonical RBD 0.0011
Further Details:      
 
Weak hits

Sequence:  PYU1_T007141
Domain Number - Region: 1-42
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0545
Family Canonical RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007141
Sequence length 180
Comment protein Name="PYU1_T007141" Note="Similar to SF2: Pre-mRNA-splicing factor SF2 (Arabidopsis thaliana)" AED:0.2093147751606 QI:0|0.66|0.25|1|1|1|4|0|180
Sequence
MDGRDFLGGRIRVELARGGSRRDDRGGRDGGRDRDGGRGGDRFERNARTPPTRTEFRVRV
SDLPRGTDWRNVKDFLRSGGEVTYCNIESDGTALAEFQSKDDMENAIKKLDDTEFRGNYV
RITAEGSDRRSRSRSPPRDRSPRRSRSRSPAQRKDSPRRSRSRSVSPAAAHSPPPRKNSV
Download sequence
Identical sequences K3WQ99
PYU1_T007141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]