SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007142 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007142
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000846
Family Canonical RBD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007142
Sequence length 60
Comment protein Name="PYU1_T007142" Note="Similar to rsp-6: Probable splicing factor, arginine/serine-rich 6 (Caenorhabditis elegans)" AED:0.568680450731913 QI:0|0|0.5|0.5|1|1|2|0|60
Sequence
MGTRVYVGGLPRDATSREIQDGFSRYGHVSNIWVARNPPGFAFVHDGAVGWIFSSPLLHR
Download sequence
Identical sequences K3WQA0
PYU1_T007142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]