SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007184 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007184
Domain Number 1 Region: 21-198
Classification Level Classification E-value
Superfamily eIF4e-like 3.66e-67
Family Translation initiation factor eIF4e 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007184
Sequence length 329
Comment protein Name="PYU1_T007184" Note="Similar to Eif4e2: Eukaryotic translation initiation factor 4E type 2 (Mus musculus)" AED:0.220638611175695 QI:0|0.5|0.57|0.71|1|1|7|0|329
Sequence
MAGGDDKRSKDAGEGKVDAVIPGETPIQNMYSFWYIKRNTGNKAESYEKSIKEIGEFKTV
QGFWRIYNHLMRPNDLPNTMDYHLFKTGIKPMWEDGANRRGGKWMVRLRKGIASRYWEDL
VLAIVGEQFDVGNEICGAVISVRYNEDIISLWNRNADNNEALYRIRDTMRKVLNLPQFIA
LEYKRHDASLTDNSSFRNTTLWRSDSKTGGEGNAGGQNAGEQRRSMHRSSSSSNQKDSSS
GNRGERGDRGDRGDRGDRGESSGRFSRDKFEKQSSGGQSRSGWRDSSKRPFFSKSNSSVS
EDHHEGGSRSGNASDRSNSMDNTNAWQQK
Download sequence
Identical sequences K3WQE2
PYU1_T007184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]