SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007212 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007212
Domain Number 1 Region: 75-156
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000126
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007212
Sequence length 219
Comment protein Name="PYU1_T007212" Note="Similar to Tmub1: Transmembrane and ubiquitin-like domain-containing protein 1 (Mus musculus)" AED:0.470860907929873 QI:0|0.33|0.28|0.57|1|1|7|0|219
Sequence
MQNHEGEHAPLLQPQPQAASDPSAPELDEWALVDDDAEYDAEPLTQESGPTPSPPDHVPE
SATTEVKDDVPDGCLRIRLRTGEELRPAWFKATQVVDDFVAEFFADAVAEGKKIRLIYMG
MLLIRDRSMGEYGIEEDGVIHCVITEAPPTPHPQAAQNGELKGFTDPTNALLIITGVFLY
GLWTLLYHFPHLFSWKSIVLLSLFSAAHVSATVSRFMRA
Download sequence
Identical sequences K3WQH0
PYU1_T007212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]