SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007271 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007271
Domain Number 1 Region: 355-523
Classification Level Classification E-value
Superfamily PRTase-like 0.0000000000491
Family Phosphoribosyltransferases (PRTases) 0.0032
Further Details:      
 
Weak hits

Sequence:  PYU1_T007271
Domain Number - Region: 172-224
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000454
Family Recombinase DNA-binding domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007271
Sequence length 554
Comment protein Name="PYU1_T007271" Note="Similar to UPT1: Uracil phosphoribosyltransferase (Arabidopsis thaliana)" AED:0.0828027253559169 QI:0|0|0|1|1|1|2|0|554
Sequence
MHSIPSLARGVDAKDEGLVLGLWTPPQGLKGEGRRPVMAPPPPTLPGLAAFLQRSSSQES
IASSGSGSSTPPSSHQHHLAPSRETGTGYFTADAMSLKRNHRRVPSRTSSYSDTDGSPTL
HAFKHINLRAPVTRHSLDATMTMSSSNSKTATIMSSNYKSKPESNSSARPQLLRTSRYLR
EVDRRNILRRIENGEKQADLAKEYQVSRAAISNLKQRRHRKDNIREDDDDTDTTDLQQVH
HEREFSQQLSHLHQHAPKATRPQHPEELAVPTQSQQRHDNHPPHQYLDVHRAQTPPQPHQ
NYEPRPVGAHYSPFISTQAASFAATVAGRPSSISSRKNHYPQGLAQVTIGTMEILFAQLV
DQRTGVRTFDIIVKRMVRLLLEHAMGLFPTRDFEISASTASANCIGIGYTKPTCAVALTD
RGTLLLREFQETDPYSDTGYISFPQTSGVPVVQLPKRVGGSNILLLDSFCSQSGHELLFA
IKSILAAGGLESDIYVVTILSHEEGLRALMQTHPRIHILTAKILPAVDPELPPTASSLAH
DLVHYVHSRLFHSV
Download sequence
Identical sequences K3WQM9
PYU1_T007271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]