SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007279 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007279
Domain Number 1 Region: 34-228
Classification Level Classification E-value
Superfamily Ribosomal protein L1 4.06e-62
Family Ribosomal protein L1 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007279
Sequence length 229
Comment protein Name="PYU1_T007279" Note="Similar to RPL10AA: 60S ribosomal protein L10a-1 (Arabidopsis thaliana)" AED:0.0610687022900763 QI:0|-1|0|1|-1|1|1|0|229
Sequence
MSKLNSELLAKAVADILAFSAGETIHVNGQDVKGKKRNFAETIELQIALKNYDPQKDKRF
SGTFRLPTVPRPNMKICVLGNAVHCEMAEKAGYEFMTVDDLKKFNKNKKVIKKFAKKYDA
FLASDTLIKQIPRLLGPGLNKAGKFPTLVGSNEGLGEKADQVRATIKFQMKKVMCLNVAI
GHVGLKPEEIVVNTQLAANFLASLLKKNWQNIKVLYLKSTMGPPQQIFY
Download sequence
Identical sequences K3WQN7
PYU1_T007279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]