SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007290 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007290
Domain Number 1 Region: 159-348
Classification Level Classification E-value
Superfamily PRTase-like 0.000000166
Family Phosphoribosyltransferases (PRTases) 0.0044
Further Details:      
 
Domain Number 2 Region: 52-107
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000205
Family Centromere-binding 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007290
Sequence length 400
Comment protein Name="PYU1_T007290" Note="Similar to uprt: Uracil phosphoribosyltransferase (Dictyostelium discoideum)" AED:0.0956742419569452 QI:0|-1|0|1|-1|1|1|0|400
Sequence
MVGMRRAKSASSLSDVQQFKMDSSPSSKSTSSASTSSITNTSGAACTGTGTGKKSRYLRE
MDRRAILARLDKGEKQSVLAKEYQVSRSSICNLYKHRDEVLSRVNQNPFTKHPKKPRAGG
IANKATEKLITCVKAIYSPFQSAAAANSTGVATTFVGQVHKVNSRAASVLLSILDKPDIS
LPEFRRCSNQIMLLLIEEALVMIPTLTAAATCVGPFASTAAASPLKTKASPICAITMEQT
HHAILDVFHSVEPHCPRGYVQLERSQWHQDVKIKLVDSQLSSALYNHNVLLLDVAVTSPQ
MIAIAIESLVRNGALEAKITIVAVFVSREVVEMVQTRFPAVRIILTELECSPSAQQLPQF
LQYQERIDASGVIASSPMPRSVLFNQRLEHLYAASATQAI
Download sequence
Identical sequences K3WQP8
PYU1_T007290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]