SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007295 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007295
Domain Number 1 Region: 265-509
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-62
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 550-750,794-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.7e-36
Family Extended AAA-ATPase domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007295
Sequence length 1005
Comment protein Name="PYU1_T007295" Note="Similar to mcm2: DNA replication licensing factor mcm2 (Xenopus laevis)" AED:0.0784241198552116 QI:0|0|0|0.5|1|1|2|0|1005
Sequence
MASNSSTPSSPAAAPGAERGTSDARAATASVAFGTGGLDSGLESNTEEGSPTRKRRRLRR
GSAPASQAAAPDDGPDDDDDGSDAAGEGDDGYGRAAYRDDLDGVDDDFGDQAEELDEEIV
DELDIQGRERQYFSEEEDDDEGEDLGENAEMDYRRMETLDRYDADQLDDRRYEDMDMDTR
RQVEEELNRRDAREGRIAQVFQEDQEMERDDAHRRRFRRGRDDEYGFGANEQELEDEEII
NLEHFDVPLREWIATERPRNEIKRRFKNFLNTFVDRNNQLLYHQKIVKMAQRNEQSLEIE
IGDVIHSMSMIAAWIVEAPKDMLTILEEVARDVVLALFPYYDTIHQEIYVRILDLPGTEN
LRDLRTAHLNFLIKVSGVVTRRTSVFPQLKLVKVNCPGCGTVIGPFTQQNHQEIKLNSCP
ECQHRGPFPVNTEQTVYRNYQKITLQESPGSVPPGRVPRSKDVILVGDLIDKARPGDEVA
ITGIYTNTPDPTLNLRDGFPVFKTVIEANHVERRADVLGSKILTAEDKKAILKLAKNPNI
GQILINSVAPSIYGHQQVKTGLALALFGGKPKFIKNSRVRGDLNVLMVGDPGTAKSQFLR
FCKTTAPRAVYSTGKGASAVGLTAGVSRDPFTKEWVLQGGALVLADKGVCLIDEFDKMNE
QDRTSIHEAMEQQSISVSKAGIVTSLQARCSVIAAANPIGGRYNPARTFAENVELTDPIL
QRFDILCVLQDRVDPVDDERLADFVISSHMRSNPLKHAATAGENGQGQRPEADSDEDSET
QTDALTQMTKSMNVSDSSGGGMTIDQELLQKYILYARTYVNPVMASDLDTRKVETFYAQL
RKASQHTGAVPIAVRHIESLFRMAEAYARMHLRDNVCNDDLDMAIRVMTECLCEAQKYTF
KRQWRRLFRPYLTYRQDNNVLLMHVLHELFQAAHSYHQLRMQTTQSSKFAKQQRHATTLS
VLGTDLLAKAKAVGIYDLSEFFNSPAFVKQGFRYDEAANAILKDI
Download sequence
Identical sequences K3WQQ3
PYU1_T007295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]