SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007300 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007300
Domain Number 1 Region: 158-361
Classification Level Classification E-value
Superfamily PRTase-like 0.0000000829
Family Phosphoribosyltransferases (PRTases) 0.01
Further Details:      
 
Domain Number 2 Region: 65-118
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000134
Family Recombinase DNA-binding domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007300
Sequence length 374
Comment protein Name="PYU1_T007300" Note="Similar to uprt: Uracil phosphoribosyltransferase (Dictyostelium discoideum)" AED:0.258666666666667 QI:2|0|0|0.33|0.5|0|3|1|374
Sequence
HERPSASGRRANSEHDSQHKEDESRSDESDSSSSAVQIHNASSRFHDDSVAAKDMPHAGG
FQNQKPSRYLREMDRRAILARIDEGESQSSLAREYNVSRSAICNLNKKRDQVLARRHENP
YAMHIKMNRTKPRNRSKLSLSGLPNAVFDPVLDAAPGVHRIRTRAIVFLLATLVDETTPD
AIFARSADRLMRNFVEEATAFIQMRNKAEAQNCQEVTTNSDGAPSSLCAITMEQYSCPML
EHFHIVEPELQSGYARIQLCAPANSTRSDQDKVEKKSPIVTLLSADLPESLDQQSIVLLD
SFLYGEENRTLDGTIEQVLARGALEKHIAVLTFFISSETVERISSRYPDILILTVEIVDS
LEDITKAENVECVI
Download sequence
Identical sequences K3WQQ8
PYU1_T007300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]