SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007302 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007302
Domain Number 1 Region: 104-312
Classification Level Classification E-value
Superfamily PRTase-like 0.000000765
Family Phosphoribosyltransferases (PRTases) 0.021
Further Details:      
 
Domain Number 2 Region: 11-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000986
Family Recombinase DNA-binding domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007302
Sequence length 312
Comment protein Name="PYU1_T007302" Note="Similar to uprt: Uracil phosphoribosyltransferase (Toxoplasma gondii)" AED:0.00147492625368728 QI:78|0|0|0.5|0|0|2|0|312
Sequence
MPHAGGFQNQKPSRYLREMDRRAILARIDEGESQSSLAREYNVSRSAICNLNKKRDQVLA
RRHENPYAMHIKMNRTKPRNRSKLSLSGLPNAVFDPVLDAAPGVHRIRTRAIVFLLATLV
DETTPDAIFARSADRLMRNFVEEATAFIQMRNKAEAQNCQEVTTNSDGAYVSSSAVSSPS
SLCAITMEQYSCPMLEHFHIVEPELQSGYARIQLCAPANSTRSDQDKVEKKSPIVTLLSA
DLPESLDQQSIVLLDSFLYGEENRTLDGTIEQVLARGALEKHIAVLTFFISSETVERISS
RYPDILILTVEI
Download sequence
Identical sequences K3WQR0
PYU1_T007302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]