SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007306 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007306
Domain Number 1 Region: 318-491
Classification Level Classification E-value
Superfamily PRTase-like 0.000000000224
Family Phosphoribosyltransferases (PRTases) 0.0012
Further Details:      
 
Weak hits

Sequence:  PYU1_T007306
Domain Number - Region: 208-256
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00148
Family Paired domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007306
Sequence length 544
Comment protein Name="PYU1_T007306" Note="Similar to SPAC1399.04c: Probable uracil phosphoribosyltransferase 2 (Schizosaccharomyces pombe)" AED:0.100917431192661 QI:0|-1|0|1|-1|1|1|0|544
Sequence
MQQPPISRPRVVVHPTASTGASAASMAYRPPHGSYPQPYQQPPPHLRPQPFVQPSSSPQA
RQNRSATGSPTLPGISTMLMLPKGSNSSSTPTTMDAMSGARAPLHSPMVNDQQHQVSGAK
WTPEMASISPIKSNAMDGGRGAAAMYYDACSSGQVEPQMARLPSFRNSSESQDDSDATTS
ATHQDDDGVASTPAGSEEGGERIANPSKNSRYLREMDRREILARIEQGEKQATLAKEYQV
SRAAICNLNKHREDVMSRKDENPLAKHPKKPRPKSTKIKIRASKSKKLTSTSPRGRCGIG
SGMGAGGKAHTYEVKSRAAALLLTSLRNKNTTIHEFQRSSERLLRLLIEEALSLVPIKSV
EVYLSDSVKADGVGWEHPPCAVTMESPMCRPMLGLFHAMEPEQPTGIVHMEQAAAISSSQ
LPASLQYHNVFVFALSATSADAICVVIQQLQARGAVEAMISIVAVFITSEIIASVHTKYP
SVKIVAAQIDPSGTQPQQVEQQTGNVETSESASASSCCLQFVLNRFHEVYHSASTTTMAS
PMAH
Download sequence
Identical sequences K3WQR4
PYU1_T007306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]