SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007325 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T007325
Domain Number - Region: 175-358
Classification Level Classification E-value
Superfamily PRTase-like 0.000918
Family Phosphoribosyltransferases (PRTases) 0.0071
Further Details:      
 
Domain Number - Region: 73-155
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00806
Family Recombinase DNA-binding domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007325
Sequence length 423
Comment protein Name="PYU1_T007325" Note="Similar to UCKL1: Uridine/cytidine kinase-like 1 (Homo sapiens)" AED:0.382640180706883 QI:0|-1|0|1|-1|1|1|0|423
Sequence
MDKFVTARTRNTHEAAVSLRTDAAMQTPSIPPLRRKTSTSSDNTTSSNFEDDTSIGGPQH
TPLKPRSAPPRQSKNSRYLREIDRRVILSRIARGEKQSALAKEFQVSRAAICNLNKHRED
VWLRRDENPLAKHPKKPRAKPAMTTATAPALVENRPTSSSTPSSPPMRSKHRVFEVTSRS
VAILLTMVRARNAVLTECRRYADRLLRLVIEDALLLAPIERLQAHINGEHKHARCGIALR
PSGVPMLDMFHLMEPTQPTGCVRRRSSSQPLNLAFHSQNLSSLSPTPLLYQHNVFLFDVA
VQASDSEALVDAVALLVHHQGAVESRIWVVTLSMAATTITRLHSAFPRVNFVAVHIDASP
ALPSPFIHDVANTGPSRPKNLEVDMLVARFDKLYTLSAPVVVSSPSADRKARIQEEDNGV
VQG
Download sequence
Identical sequences K3WQT3
PYU1_T007325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]