SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007355 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007355
Domain Number 1 Region: 372-511
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.16e-43
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00015
Further Details:      
 
Domain Number 2 Region: 550-714
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.81e-30
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.003
Further Details:      
 
Weak hits

Sequence:  PYU1_T007355
Domain Number - Region: 2-264
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000568
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007355
Sequence length 967
Comment protein Name="PYU1_T007355" Note="Similar to its3: Phosphatidylinositol-4-phosphate 5-kinase its3 (Schizosaccharomyces pombe)" AED:0.195764462809917 QI:0|-1|0|1|-1|1|1|0|967
Sequence
MVSVASLVGCVYVIVSYLYIRALRQHPAGIMFGMSIYGAIYQFLYLLDRSSESIQCSQMG
VFVDFFLTGQETYMLIFAIDLLLALQNPFSASKGQMKKYHIGGGLWSLVCATISHFDTHY
ALFGFCWMSSSDDHLIWVRGFSDTSTGTVPPAGEAVSNGTITSGIFFALYIVVVYCTSLV
AILCTWNRFSKGLPDTFKTRQRIHRHLKYYVGCYFGYWTLVLGCYALFSLMPRENTDGKG
GVRCRIWHLLKCLLLAKGMVNSLIWTRTSNILTIIEQLREFGYVDLPAHEDSINWALRLE
ILTKTTRGICESIDYAEHEARASGVLSPTSSAEDLGHCISNLDSEFCERKESYAQIRTII
LETRNDRRARGPMSEGVVFYDFAPHVFRRLRGEARISSSSYRNSLQQTTKERVSEGKSGA
FFYFTEDRKYVVKTLTKEELKFLLSILPTYYTFIKNNPNTFMTRFFGCHGLTMYGKTVFF
MVMQSVFDSNLQIHERFDLKGSWVGRLEGRKPSGTIATCKFCSVEFVVGGSHDQLCGVRR
GEGNLRHQYDQVGKDLNWNRHMALPFLTARAVAVQLTKDSNFLCKINCIDYSLLVGIHHR
SFNVSHYSSADNFEHPPRGSSGSIGGVSRDRASSGGGGFDPTMKPFHQAIQGGMSVDEVH
GPGIYFMGLIDILQQWNLRKRVEHFVRVYIFMQDKNGVSVVNPRQYADRFQQRVIRELIY
DGNLEMDEVEMMQLQFQEPCNMQLMESGFTRSTMIESFNTRCDSTAMLERMSSFLTPPQM
TTPIMPMRFSARMASSGVSSAAARSSSQRQRAATVSTGLPEHYSLGPRFSGGLVMEPPRG
FYAPQPNNSVQQPPAYLPPPLSSSSSYPLPSYVEMSSTNVRQPLAPVTPSPRVSCVTFSR
SDSEASLLRFDRSLSSVVPISSSAPPPPTSMTIETHMTEPHHLTSLDSYRIVRTPTLTPD
KLPTLSA
Download sequence
Identical sequences K3WQW3
PYU1_T007355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]