SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007388 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007388
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000645
Family Ubiquitin-related 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007388
Sequence length 106
Comment protein Name="PYU1_T007388" Note="Protein of unknown function" AED:0.0701219512195121 QI:67|1|1|1|1|1|3|176|106
Sequence
MIPYIRVKRKNQTVFVDVQFSDTFASVKDKLGALFHMAPQHIQLWLGLNQKESKELTDVA
TLADHDLQNDSVIYMCWKKENSDQWEELSVTKVEALDTDSGAKAEA
Download sequence
Identical sequences K3WQZ4
PYU1_T007388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]