SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007473 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007473
Domain Number 1 Region: 147-308
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.27e-43
Family Dual specificity phosphatase-like 0.00000272
Further Details:      
 
Domain Number 2 Region: 472-549
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000817
Family PLC-like (P variant) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007473
Sequence length 728
Comment protein Name="PYU1_T007473" Note="Similar to PTEN: Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN (Canis familiaris)" AED:0.172839506172839 QI:0|-1|0|1|-1|1|1|0|728
Sequence
MLSLTKLRKSRATESGADVVELISISAPPSPPSSQKGLQKTSPKVKPMIIIDEPTSPSSP
VGEDAELPSPTLLRASIRPTTLSLDTMSDPSSSFSTNELESAPSSPTASSSSPKSRDSQS
QMRGFSKVSFRIKQLVSKEKRRFAEDGFNLDLTYVTNRLIAFGYPAESLEGIYRNHYKDV
YNFFEKRHPGRYRIYNLCSERTYDKEKFHNRVAEYRFDDHCPPPIALFLPFCQDVDEWLQ
AHPENVAAIHCKAGKGRTGVMICAYLLYIGAWKTAHSAMEFFGAARSLKRQGVTIPSQRR
FIGYFGEMCHRTRRSTRDETEEMKDDIDTDVTRENELDVAEYKSLWEDALEGRGIATKRR
MFQRQLALPASKHLKLVSITLSGVYTQRKLDPRVHIECGKTSERSPFAYHFNRPFSDVHA
LAARVATSEMDKHDSVDASEAREAPPSPSSSPSSGRGSTSMPHTELKLVCDRCIVWDEVQ
VHLRNRNGAKIGHFWFHTSFVACNTTRDDDGDDTLELVLKKHEIDKVIKDIKRGHKKYAP
SFCIKVCFKYATEEEIQAAESVQRMALKVDSAAANSSSSSLLTTRFSSPGSVAPDKTKAV
WAVEKRSEGQPHKQFSRSSKTSSSPAAATEEHQHSKSDRGAQSRQTALFTKQRPSPLVAN
DTGAEQAQTDGSVEVFGTRRGGDDASEEDTSTSVRPVEAACASPKAASPRQQLTRFFSAR
KKEPPTDH
Download sequence
Identical sequences K3WR79
PYU1_T007473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]