SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007512 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T007512
Domain Number - Region: 139-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000571
Family Cold shock DNA-binding domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007512
Sequence length 209
Comment protein Name="PYU1_T007512" Note="Protein of unknown function" AED:0.019047619047619 QI:0|-1|0|1|-1|1|1|0|209
Sequence
MDSRCIKFWEDGQELLKNAANAARLAHAMGKILKELRTMSRFLQKNQASRFSDNAQQKLV
DAVAFYVTFSKQRVPIQSGDDQQLVEAVFQVIKDGLAMPFNVMGTKQKKRLMKWYNELIG
VVGGDPDALALDGVDSAPKRMEWSVLGIDDDGYLSLMDESNGDTCETFQVKKSKEFKQIQ
KGLETTDVTVVTMGEDIVEIQVADGDAEE
Download sequence
Identical sequences K3WRB8
PYU1_T007512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]