SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007536 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007536
Domain Number 1 Region: 217-363
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.64e-47
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00000593
Further Details:      
 
Domain Number 2 Region: 9-209
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.06e-42
Family ATP-dependent DNA ligase catalytic domain 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007536
Sequence length 381
Comment protein Name="PYU1_T007536" Note="Similar to At1g08130: DNA ligase 1 (Arabidopsis thaliana)" AED:0.00738916256157629 QI:0|0.5|0.33|1|1|1|3|254|381
Sequence
MVFDRFQGMPFTCEYKYDGERAQIHILPNGEIAIFSRNFENSTERFPDVKLMIAKATKKS
NLASCIVDAEVVAVDKATNKRLPFQILSTRSRKNVKVEDIKVPVCIYAFDLLFLNGESYL
TKTLAERRAKLKKVFELEDGSFELASSIDIAATEDIKDDAEAMEVAVDKVRTFLEEAVKE
QCEGLMVKTLHKEATYEPANRSHKWLKLKKDYLDGIGDSTDLVPIGAFFGRGKRTGVYGA
YLLACYDPDTEMYQPITKLGTGLSDEVLKTFHEQLKEKVVDKTPQDYATGDGINPDVWFE
PTVVWEILGADLSISPKYTAAMGLVARDKGISLRFPRFIRIRDDKSTTQATTSNQIADLY
RAQGLVTVSGGAEDEDDDMLI
Download sequence
Identical sequences K3WRE2
PYU1_T007536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]