SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007550 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007550
Domain Number 1 Region: 133-271
Classification Level Classification E-value
Superfamily Translational machinery components 1.35e-51
Family ERF1/Dom34 middle domain-like 0.0000714
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 4.84e-43
Family Dom34/Pelota N-terminal domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 262-370
Classification Level Classification E-value
Superfamily L30e-like 5.89e-31
Family ERF1/Dom34 C-terminal domain-like 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007550
Sequence length 408
Comment protein Name="PYU1_T007550" Note="Similar to pelo: Protein pelota (Drosophila melanogaster)" AED:0.00244498777506108 QI:0|1|0.8|1|1|1|5|0|408
Sequence
MKLLKKQINEKDGMGSVVLRAEEPEDMWHVYNLIHVHDSVKTTTIRKVVKEGTTGSTSSQ
RVRMTLQIEVEQINFDPALCVLRIKGKNIMESQHVRLGAYHTLDLEMNRDFTLFKNCWDV
MSLERIETACDIAKKAELAAVVMQTGLAHLCLIKGHMTVIKAKVENSIPKKRTGSTAHAK
GTEKFYENIVRSIKQHIDFKLVKCVLLASPGFVKDDFFKFMMEQAIRQDDKLIMENKNKF
ILCHSSSGHKHALDEVLNDPTIQSQVADTKAVEDVKCLETFFNMLHTDQDRAYYSYKHVV
AANANMAIETLMVTDELFRSQDIATRRKYVDLVESVRDNGGTVRLFSSLHVSGEKLGQIS
GVAAILRFPMPEIDEADNSSDSDVSDAENDNLNDESGVGDLSMESLSM
Download sequence
Identical sequences K3WRF6
PYU1_T007550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]