SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007564 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007564
Domain Number 1 Region: 51-258
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 3.14e-36
Family MPP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 265-442
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 4.19e-22
Family MPP-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007564
Sequence length 449
Comment protein Name="PYU1_T007564" Note="Similar to MPP: Mitochondrial-processing peptidase subunit alpha (Solanum tuberosum)" AED:0.00111111111111106 QI:0|-1|0|1|-1|1|1|0|449
Sequence
MLARSQVHKCVSRAASRSFFKSANVGGAQVAVDEEFPGLPATHPAAPKTPTTEVSTTASG
IKIASDNASPYVTLAVQLAAGSRVETDETAGISQLFSKMAFRATEARSDLKLYRDIEAIG
GVINKDAGRDFVRYSISVLPEHTDAAAQILAETTLAPRFAHWDIAIQKDQVKAELEKLTS
NPAALLLEGVHTAAYYDDATLGRPIITTENLAKFDTEELVQFYKKYVNTSGAALLGAGIE
HSDLTEIANAYFSELPVGAPIDRTPAKYVGGESRVKTSSPVTHVAIGFETVGKRDPHYGA
ARVLRALLAGRVNPKHATAFFGSYNDSGVVGLSGHAANTNVGALAESFIAEIKSLATTPV
SAEELAVAKTVAALNAYESLGSREGVLVRLGLLGLHQVPAPSPLELADSATPQAIQQLAQ
KALTSRPSVASIGKVSAVPRVDAVIAKLK
Download sequence
Identical sequences K3WRH0
PYU1_T007564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]