SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007654 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007654
Domain Number 1 Region: 308-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-27
Family SPRY domain 0.021
Further Details:      
 
Domain Number 2 Region: 15-56
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000198
Family Ubiquitin-related 0.023
Further Details:      
 
Weak hits

Sequence:  PYU1_T007654
Domain Number - Region: 201-219
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00471
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007654
Sequence length 592
Comment protein Name="PYU1_T007654" Note="Similar to RNF123: E3 ubiquitin-protein ligase RNF123 (Homo sapiens)" AED:0.368465430016863 QI:0|0|0|0.5|1|1|2|0|592
Sequence
MADDAEFLVQFNRTLCISLPRANATVASIKKKIQSREGVPADLLDLYANGRKLLEDALVP
CLPVMVRARLSGGLRGGKGGFGAMLRSSGKGAGAKATTSFGACRDLNGRRLRHVNQEIAV
QKWREDGETREQRKKLGVTDQEIMDEETPSGIPGWYLAMPSWAEGVKKSYMKRRRNTIMC
KSWLQARENGRTAPPNAPRWWGCPRGRDCDFAHGEEELRGAGLTEYKKSKKEEVYQTKQQ
ELQKYVDYEQDIPDDIGDAIRQGMRKRNAKSKVQAKQAILEEARVLPPDATFVAVRSSDA
ASEFWLVPTGGNVGITFKNGLCELRGQSNFGTATVFGSCITSGKWYYEVRLITDGVVQIG
WADGTFGANSETGDGVGDHVRSWAYDGNRQLKWTNGQESEYGTPWEKHDVIGCLLDLDEG
TISFSKNGKPMDVAFDGIKCLDTDNLKQKGFFPAISVEETEILLVNIGAQAFLYQQEGYQ
PVLDAIRADSSTEIPRSETPKVVDAPTAPTLVPEPQEPVQEEATYEPLDLDQFESAEQLE
KLGLEALKLELQHRKLKCGGSLAERAKRLLSVRGKSWEEIDSKLKDVKAKYN
Download sequence
Identical sequences K3WRR0
PYU1_T007654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]