SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007683 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007683
Domain Number 1 Region: 140-191
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000218
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007683
Sequence length 1534
Comment protein Name="PYU1_T007683" Note="Protein of unknown function" AED:0.0286644951140065 QI:0|-1|0|1|-1|1|1|0|1534
Sequence
MDQIKQAFAQTKWILEDTATELGIKTIGRRLPWSSDLVHDEKKSSSDDLVVMHANITTST
LRLRRTILKLYNMFCRRLIPTLQRLHELDAMGDNINVSDGEQVLNFFEEEVEDLDEEDQT
VYRRVYQRLRLMRMYQVLEDIMCTTLRIKVMDQDPGIGNDLIGVAQIPLIDLLDQEEHYN
VYHLTKPHKGPNAYGVMLKNIIGNFSNPGATYGVGGDYQPTDTKPNASKAGLTYSGQVYL
RIKLTYSQSALLEEATHVYKVLKQKFITQHESSRCRINEAVVPAQRRRWMTMRGYLEELT
AQASGKLHWERTPILLSLVWDIFASHTKAISPMEGSDEEGDQLQCLADKIDKYRTAVIEV
NKRWANLQPLLDELLVMQAATQINATRTPEVLDTIETQVEGLDVVLSTAWQQVNQKWMAL
KDALEQLVAMREKNKIHMGRAPYLLNLVSQRCSKGLNSRHAEAVSNVQFRWMAITQRDGP
LCELRLMEKKGLHWRRTHELVLLLNEQCEGFAEVDAKSLDIVESRWKQVQEWLDDVLSMQ
SEHKIDCEATPFILKKMHLLEHKDKQAGKGQKQASKLRSIQASSPSKRSIAAVASKLSLN
NPTEDKNFAQASPPASPSATTDQQFPGFDAAENDAGRLEGLIEWYAIEEAKYELERVPYH
RITTDYDRNNWLPYSHDGKDTRLSITQEEIAFTAANVRAALEDRGVIPRFSSYLGYGMDP
LSVNRTGDAAPLSASALQKDLLDEINELEKAMELEGDINNVRPQVLSNPERFAELHSVIE
NLNKTDLLWKIDHVVNTNKELEAPENFLRLLDEMKMRQIPTNEVENLVRALTVVLQKEEL
QRLGINVPSTASYTTVLSLMHRHQVKDISLPFETSAIQTLLQERGMDRKGEPVFLRGMRI
GTQSVVDDGQSTNSALTKKSIHPSGATASSTLNCSLGLIDTQIELLRKSMLFEALRKRNS
LIKTFPGETKVLTEEDLSECTEVDTSGDYMTLIERFQQLLIHESYTKRLASYAALDRCMR
ALLRVPCDQIVTKEDIAIALHGLGNSKYRLPVEAFTREELLEAASAGKIRTPTEQMLSRC
PQGKNAKAMAYYAAISHAAMIYQEVTSFSSRFDPIGNRFQDCIPIDLKSTIDGVVVPKDR
SRHNLKAYVIDWLLGSEDTAMRIQRQLSAYHQQRLVWASSAFTLCNRWFQCGYGWCDDAS
KGVGVKVLLQRLLLFEAANKMHMVNTEALLREINDKCTNLRARDKRAKEILEERYLRNVE
MLEKLVGFAERCMNNRKLHSEETPALLHEIEQVCVVPHGLNARYMEAYHVVTSHWVPHRE
RLNELVKMHKEGTFSIHRTPELLNAMEVHTEGIAGARELDEESIYASVSASGETLDNQKE
MIEKKIDEIRRGQRKAPSSLHLDLEDPSSVPDILAASAETMKRESGDWKSLSPSKRVVQA
LSPHEKQTSWKVVTSGSTSPTKLGQQAVVLETKMASTGSTSPRRKSLLSDEIKELLKSPS
KWLLSNSEPVVERIRPEEFFPQAVSHDSSFISKE
Download sequence
Identical sequences K3WRT9
PYU1_T007683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]