SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007685 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007685
Domain Number 1 Region: 799-899
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000278
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 
Weak hits

Sequence:  PYU1_T007685
Domain Number - Region: 112-163,202-260
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000159
Family DEP domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007685
Sequence length 1322
Comment protein Name="PYU1_T007685" Note="Protein of unknown function" AED:0.116440072991237 QI:0|0|0|0.5|0|0|2|0|1322
Sequence
MLRASLTPTENTQIDAFHVVLVIVMKRIVSILCEIQLFEQFEVLEKEEMQKFRHVHTTSA
DPNSEWIGRLINEIKVETRKDIVLHLEMELLELGASKTSIEIPVTDLEREEWIKLRAVRQ
KALQDIGGFFIQDRTNVLFLSYPNSFTGEGMISWILRSPSILWEDGWKKYCQDPKIKSSC
LLQWKDGKLEQDPDAIQPPRSRESALMWLCGLSDAGYIENVTSSGAATDANINYYLVEDK
TDRFYRLREVDLWLKKQSREKSLFPLDLVQEIDCYQSPLSGLTPADVNLNPEAEHKSVFS
KKLTDHVEDFLGTHTKISTLLFSPEIKATDLLKPVVEKTKQLLDEDMLWDWKYCLFIPDY
RSIYMYEAETCSCPFAIIDMNSGSCHASYSSIHEDKGGWFEISNATVFVRDSASAKYLPI
DDERKAKMMKLKPDGSMVLEFKSADAQRWIQALLRAGVKMKLQVGQLVVMKQLNAIVLQQ
KCIEYSTEYLPHDLEGSFQRLLNRFFGHDLDSSHHEYEEKMRELRAQFRCEMKKTGHLGD
TVLAYYGKGKKLNPKPTDSRSFTPGALYSGRIVRIRTPYIDSKYHVATLYDRNDKNEVPP
EVEQLLLKYKVKDKASWLKLPTTLRDVFLLYDIEYRHSHETIIEEGMLREHFRAANGDLD
AAKVEERCIDSNLLFKPNDLEDCVTRMTINCNGRKPLGCLKIPIKMVSPHRVSDVWYPLA
PESEMVQKMHLGQLRVQLRLTHVNELVRSETRPALLEELKDAVAKHQLLQPYIPSSLSFF
TNKRSARLPSGGSSVNSREQSFLKISIHEARKLVPSDVRQRNPFVKIVLLHEKNEKEEYT
RLKSDVKPKTVNPKWQNQEFVLGKTEATVLSDKKAVLLRVLDEESVREFSLGCVKLEFQR
DKSGFIIGLVLIHADAKGNPTRQALNLDNKNQIEVEAMLLGDEKARQDKSAKAKGNDAGL
DGRLGKLRFGIELIKNENFVNQSTLPSPSKMAVQKHPDTKFSAEVKVKRIGCVNSTAVKL
VEAEAFDWRQYTCVFQPHGEGGHRILYDSHFEDFTQGNKHRLSDLLQLGNASSTNSGDTD
SSTSQFGSCKFLGRTYDVSKVSYFDVIVSSDVLGKTFQGKFEKAEIWKRPDLRTSFENEA
IVLKDKDNKDVELQMLVDITLVGIHRAERLKRVLAETFRVVGLPFDAKTMNHHTVNNNQL
HTSSYLQNFLWEVFRVNMFPSKNISQELMAQVHRMSRSTKLHWRFTPQLLSCIYEHVFIR
GEKDLLSFRDAAALDIVLSRWSQIVTHVSEAKSQLIGHLHGQETPELVHAVFTKVLVLRL
GS
Download sequence
Identical sequences K3WRU1
PYU1_T007685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]