SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007692 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007692
Domain Number 1 Region: 124-370
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.03e-64
Family Regulator of chromosome condensation RCC1 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007692
Sequence length 386
Comment protein Name="PYU1_T007692" Note="Similar to HERC2: Probable E3 ubiquitin-protein ligase HERC2 (Homo sapiens)" AED:0.041350531107739 QI:2|0.33|0.25|1|1|1|4|46|386
Sequence
YTWGSGSLGQLGHGAFIKSGIRNAYEELLPKRLEAFEGKSIVKLEFGATHSAAIDDKGRV
YMWGSNEYNKLGLGPGTGEFESLPHLMEAFEGIEIVDISCGDYYTAAVDSEGKMYSWGWG
GSTMKGAGGLGHAGGKDEPTPRLVRALVDQGVPIASVECGELHTVALSKDGEIWAWGNGE
YGRLGNGETDTFEIPEPIEFFSDENVVAISAGRDFTFALTEEGELYGWGVNSHNQLGVGG
GLAMDHYNMEAIPTLVEGFNGVGVKQFAAGYDHAAAVTDDGRLYMWGSKLWLEPHEMTAL
EGETIVQVACGRTYTVALSADGKVFTFGKGSSNCLGHGDRKNQLQPLQIVALANINVTSV
SCGDYHMGAISMPHATAMDKDFSFRE
Download sequence
Identical sequences K3WRU8
PYU1_T007692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]