SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007703 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007703
Domain Number 1 Region: 285-424
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000118
Family ECA1476-like 0.093
Further Details:      
 
Domain Number 2 Region: 207-253
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000000359
Family Leucine zipper domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007703
Sequence length 430
Comment protein Name="PYU1_T007703" Note="Similar to CREB: cAMP response element-binding protein (Chlorohydra viridissima)" AED:0.0537450693949488 QI:0|-1|0|1|-1|1|1|0|430
Sequence
MSHRRVGAAGQQSRMAAEKNSLHRCAVTLCANPAVSEGVCAMHLSRPGRSTAPPSNTALA
TGYASPGFGHPHHHGAASSMSPDGQHGTPDRFYRSGAHMAMQPRAGPASKKQRTTTNAPG
AGLEPPGNHYSHYPSGGMALTQDSLDQMNQTNQLRFPKAPGGRIGLAASPYDDNAYLSHT
MRPSGSTNDSVHSESENSMDADKETNQRRERNRIAARKSRQRKLDRISNLEDEKMRLEQH
RDMLVQEIRSLEKRDAASGGASGAASTSVVSIPDKEYAHLQDVRIRIIKAVEDAYNNGNI
ASTLSFLRDDSIVSGPQNSSVHLRGRDALVLDYLCTTYLFSDIHLHHAKIDSGGPRSQHF
RVHWIFTGRVKSAGVSMNKEFLELIESVKGKRVTIEGVSNFSFSGDKIVYVHRTADQAKF
LSALVNLSKE
Download sequence
Identical sequences K3WRV9
PYU1_T007703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]